VerifyRecall
Alerts
RECALL RECORD — CLASS IIRecall closedF-0510-2016/FDA enforcement
This Bar Saves Lives·Food·Dec 21, 2015

This Kid Saves Lives Chocolate Chip

What you need to know

Class II

  • What happened

    This Bar Saves Lives is recalling This Kid Saves Lives Chocolate Chip because the product contains whey protein and does not identify milk.

  • Health risk

    The product may cause temporary or medically reversible health consequences, or the probability of serious harm is remote. A safety issue that does not fit the standard pathogen, allergen, chemical or quality categories.

  • Action required

    Check the identifying codes below and stop using the product. Return it to the retailer for a refund or dispose of it safely, following the recall notice.

Recall closed · classified by the FDAIL, MN, OK, ND +24 moreMore food

Advertisement

Ad

Know someone who bought this?

A quick share can keep a pantry check from becoming a missed warning.

Share via WhatsApp

Match before you discard

Product identification

Source: FDA FOOD

Brand nameThis Bar Saves Lives
Recalling firmThis Bar Saves LivesVenice, CA, United States
UPC / barcodes
10 858497 00409 78 58497 00409 0
Lot / date codes
  • Inner pack(5 bar carton) - BEST BY APR APR2916 and BEST BY JUL2816 Case(8 inner packs) - BEST BY APR2916 and BEST BY JUL2816
Distribution area
ILMNOKNDWIIAKSCAMDTNNMFLGAPAVALANCTXRINYMAOHMEAKMICTNJWA

U.S. distribution to the following: Distributor- IL Retail- MN, OK, ND, WI, IA, KS, CA, IL, MD, TN, IA, NM, FL, GA Online Consumers- FL, PA, VA, LA, CA, MD, NC, TX, RI, NY, MA, OH, ME, TN, GA, AK, MI, CT, NJ, WA, IL, IA, OK

United States

Quantity affected20, 829 units
Recall initiationFDA report date: February 10, 2016
FDA recall numberF-0510-2016

Beyond the headline

The recall, in context

This Bar Saves Lives initiated this food recall on December 21, 2015. The FDA enforcement report states: This Bar Saves Lives is recalling This Kid Saves Lives Chocolate Chip because the product contains whey protein and does not identify milk. The FDA report lists distribution as: U.S. distribution to the following: Distributor- IL Retail- MN, OK, ND, WI, IA, KS, CA, IL, MD, TN, IA, NM, FL, GA Online Consumers- FL, PA, VA, LA, CA, MD, NC, TX, RI, NY, MA, OH, ME, TN, GA, AK, MI, CT, NJ, WA, IL, IA, OK.

The FDA enforcement report describes the reason as: This Bar Saves Lives is recalling This Kid Saves Lives Chocolate Chip because the product contains whey protein and does not identify milk.

This Kid Saves Lives Chocolate Chip was made or distributed by This Bar Saves Lives in Venice, CA, United States. This page reflects FDA report F-0510-2016, dated February 10, 2016.

Why this is a Class II recall

Class II means the product may cause temporary or medically reversible health consequences, or the probability of serious harm is remote. In this recall, a safety issue that does not fit the standard pathogen, allergen, chemical or quality categories.

FDA definition

The product may cause temporary or medically reversible health consequences, or the probability of serious harm is remote.

What to do now

  1. 1

    Stop using it

    Do not eat, drink or take the affected product.

  2. 2

    Check the codes

    Compare the UPC and lot code against the table above.

  3. 3

    Return or discard

    Contact the retailer or recalling firm about a refund, and dispose of the product safely.

Consumer safety guide

Undeclared milk

Symptoms to watch for

Hives, swelling, wheezing, vomiting or anaphylaxis can occur in people with a milk allergy.

When symptoms may appear

Reactions can begin within minutes to a few hours after eating the product.

Higher-risk groups

People with a diagnosed cow's milk allergy, especially children and anyone with a history of anaphylaxis.

What to do now

  1. 1Do not eat the product if you have a milk allergy.
  2. 2Seek emergency care for breathing difficulty, throat swelling or other signs of anaphylaxis.
  3. 3Keep the packaging and contact the retailer or manufacturer about a refund.

This is general consumer safety information, not medical advice or a diagnosis. Follow the official recall notice and contact a healthcare professional if you have concerns about exposure or symptoms.

Frequently asked

Questions about this recall

What is the This Kid Saves Lives Chocolate Chip recall?

This Bar Saves Lives recalled This Kid Saves Lives Chocolate Chip in an FDA Class II enforcement action reported as F-0510-2016. This Bar Saves Lives is recalling This Kid Saves Lives Chocolate Chip because the product contains whey protein and does not identify milk.

What should I do if I bought this product?

Check the identifying codes below and stop using the product. Return it to the retailer for a refund or dispose of it safely, following the recall notice. Do not eat the product if you have a milk allergy. Seek emergency care for breathing difficulty, throat swelling or other signs of anaphylaxis. Keep the packaging and contact the retailer or manufacturer about a refund.

Is the This Bar Saves Lives recall still active?

The FDA lists this recall as recall closed. It remains relevant if you still have the affected product or need to identify a historical recall.

Where can I verify this recall?

This page is normalized from the openFDA enforcement record F-0510-2016. You can verify it directly using the official source link on this page. VerifyRecall updates its index from public FDA enforcement data and does not replace advice from the FDA, the recalling firm or a healthcare professional.

Verify before you act.

VerifyRecall is independent and not affiliated with the FDA. Always confirm the latest status on the official source record.

Official source

Related alerts

Recent Other safety concern recalls

All alerts
Class II·

Sempio Food Services, INC

Sempio Yellow Peach

Elevated level of lead in canned peaches

INFood
Class II·

Stewart's Shops Corp.

Stewarts Shops Vanilla Heavenly Medley 1/2 Gallon (1.89 L)

Foreign object: May contain pieces of metal

NY, VT, NHFood

Record last synced from official openFDA enforcement data on November 14, 2026. Source record: official FDA notice.